PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn268811
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 174aa    MW: 18270.9 Da    PI: 10.8235
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn268811genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.44.4e-10445647
                     HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     teE  l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
       Achn268811  4 TEESRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 45
                     89***************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.576150IPR017930Myb domain
PfamPF002495.7E-8445IPR001005SANT/Myb domain
SMARTSM007170.0093448IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-8444IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-12548IPR006447Myb domain, plants
CDDcd001672.98E-7546No hitNo description
SuperFamilySSF466891.11E-11551IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MTKTEESRLF LLGLDKYGKG DWRSISRNFV VTRTPTQVAS HAQKYFIRLN SMNKDRRRSS  60
IHDITSVNSG DVSVPQGPIT GQTNGSAAGA PGKSNKPAPQ TPGAPMGVGM YDAPTIGQPI  120
GPLVSAVGTP VNLPPPAHMA YGVRASVPAQ VVPGAPMNMG PMTYPMPHTS AHR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070471.11e-96PREDICTED: transcription factor DIVARICATA
RefseqXP_011070472.11e-96PREDICTED: transcription factor DIVARICATA
TrEMBLA0A151UD741e-100A0A151UD74_CAJCA; Myb-like protein J
STRINGGLYMA07G28310.17e-92(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41492445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.12e-71MYB family protein